DPCstruct | MC5715
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 67 ± 4 aa |
| Standard deviation of domain lengths | 3.84 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 79.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.80 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 67.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10500 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q4V5H0 | 2-75 | NSKSHAPETPEEYQRRQSQIRKEVDPVTGRVRLIKGDSEVLEEIVTKERHLEINKKATRGDGEFYEARSLDAAK |
| A0A833YTY1 | 2-65 | KPMTKEEWDARQSVIRKVVDPETGRTRLIKGDGEVLEEIVTKERHREINKQATRGDGLAFQMRA |
| T1FTS1 | 81-150 | None |
| A0A6P7FAC8 | 177-243 | None |
| K7CHX8 | 270-337 | None |
| A0A2J8MCX6 | 149-214 | None |
| A0A6P7D1D3 | 161-226 | None |
| S9YPG4 | 131-196 | None |
| A0A6J2Y9G0 | 200-266 | None |
| A0A2K6PMI5 | 220-287 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.