DPCstruct | MC57147
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 70 ± 6 aa |
| Standard deviation of domain lengths | 5.61 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 94.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 44.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0039 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A842PTV9 | 4-74 | ALQARIRALLLTLKADRYGGIVVGTRNRSEVVIVYTVKHGDGSADCHAIANFYKQQVRQLGEHLATSEGLT |
| A0A0G1T9B4 | 164-227 | NTKARIRAVMLYSYANTDHALVLGTSNKSELLLGYGTKYGDLAADIEVIADLYKTEVIKLADHI |
| A0A0E3ND50 | 119-180 | None |
| A0A6P4K7R0 | 41-114 | None |
| A0A7X7E446 | 54-128 | None |
| A0A2I0QIM3 | 75-138 | None |
| A0A7C0ZFX5 | 2-70 | None |
| A0A7V9UYZ3 | 32-104 | None |
| A0A836VHK9 | 2-62 | None |
| A0A831WJN8 | 72-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.