DPCstruct | MC5714
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 98 ± 6 aa |
| Standard deviation of domain lengths | 6.11 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 86.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 34.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G9VZW8 | 43-138 | LTFYEYLTSIKGMKYSTAQSRVSNCKRVEKYEGDLEEHYYKDKCKLLLSKLEYSMEDQVNNRHAAHKIPIDGNTFNGTATLKQAVNL… |
| A0A5J4RQ13 | 2-115 | KLENEFKQWLECHYPANTAGSRMTNCKNVEKSYGDLGVHLEKDRCSKIIFDLTYSTDDEREHRKAKHPVPIDGNIRNGSATLKQAVG… |
| A0A6L7TTW0 | 3-97 | None |
| A0A5B9YX46 | 2-98 | None |
| A0A5J4PT99 | 1-103 | None |
| A0A239JBZ0 | 1-101 | None |
| A0A3S1ATR6 | 2-99 | None |
| A0A844YW28 | 3-102 | None |
| A0A2K9E4C1 | 3-96 | None |
| A0A231NWU9 | 1-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.