DPCstruct | MC57129
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 101 ± 6 aa |
| Standard deviation of domain lengths | 6.18 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 79.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 17.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N6EBD4 | 1-103 | MLGPEKVAGRKIDVTLIADRWMSKAMTSDDIFEKDPLAIGGISSRGNDSNYLGSIPFDIFPAVLSMLAAGKYNYLSLHGKSLRYGKA… |
| A0A1V4WRA9 | 52-159 | KVNGRFVEPQRLLDRAIDVIILGERHIGFAMEKPLEVTWQPRAVGGLTVSKSMTDCYISIPFDALTLIAGGMEHGRVRFVTFFGEAL… |
| A0A1L6I0V2 | 1-101 | None |
| A0A5C7QRZ9 | 20-120 | None |
| A0A2M7CES6 | 180-286 | None |
| A0A1F9PA33 | 4-98 | None |
| F2A6J6 | 1-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.