DPCstruct | MC57123
Metacluster Properties and Pfam Annotations
| Number of structural domains | 970 |
|---|---|
| Mean domain length (aa) | 139 ± 21 aa |
| Standard deviation of domain lengths | 21.34 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.42 |
| Mean intra-cluster sequence similarity (%) | 12.58 |
| Pfam Score | 54.19 |
| Assigned Pfam label(s) | CL0302- CL0236- PF14280 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C9DSB2 | 3-138 | TKGQLTGMAGVYLAAAELSLRGYIVAPTSRNAQGVDLLVSNSEGTSAIPIQVKTNSTTFSFWLLSEKCKRLESDDLFYILINPRKTE… |
| A0A2N0JF38 | 4-145 | QLSLIKTKIYDKCKLTITNFILEEESKEYDACRFLLGGHVIISRNSKITPKKLGQFVTFWKRSKSGPIEPFNATNNIDFFIVNVADQ… |
| A0A5J4KWF6 | 1-157 | None |
| A0A4Q3JN71 | 18-144 | None |
| A0A3A9A6F3 | 8-178 | None |
| A0A8B5XJ33 | 2-142 | None |
| A0A2V4WBF2 | 215-357 | None |
| A0A3S2YJS9 | 9-156 | None |
| A0A519PN90 | 11-167 | None |
| K6DR30 | 30-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.