DPCstruct | MC5712
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 176 ± 33 aa |
| Standard deviation of domain lengths | 33.24 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 79.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 23.09 |
| Pfam Score | 98.28 |
| Assigned Pfam label(s) | PF03715- CL0109 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E3K9I2 | 194-365 | LLRLIQQTGTFIPLTPFLLDMIDSPLFKRQPTSTSLKALDWGYLLRCPKSHENSRVYADGVAEETSYLLLEDHACMSKSIGFPELVL… |
| Q4RVQ6 | 172-409 | RMLSTIFQQVEFNKKPGRMSKKPINFAVILKLSKVNLLEKAYKDGLIDQLYDLMLEYFHTQSHSIGFPELALPTIIQLKTFLKECKV… |
| T1NRR3 | 66-190 | None |
| A0A1D1YI65 | 12-170 | None |
| A0A7R9ABJ5 | 574-742 | None |
| A0A7S0YEI8 | 344-515 | None |
| A0A368FCN6 | 3-202 | None |
| A0A816L763 | 13-133 | None |
| A0A812PD16 | 496-679 | None |
| A0A183NJH1 | 40-217 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.