DPCstruct | MC57117
Metacluster Properties and Pfam Annotations
| Number of structural domains | 167 |
|---|---|
| Mean domain length (aa) | 224 ± 64 aa |
| Standard deviation of domain lengths | 63.69 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 85.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 13.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14022 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A497WYV8 | 38-252 | ENYFSRIESDVEGIINRISDSNSLVSIDNKDFHSLLEFISFLIARTPKRVELTQAYGTGEAMRKIIQTKAKNKVPDSEVDSFLNVMM… |
| D2B616 | 106-351 | YRIEHPGVDADQVPPLLFETMLSRIEGNAKTVIDELISHRDVRALDPEHLALFAWHLALSITRGKAFRAEQREMLTDTYRLQYAKVT… |
| A0A0D7KDJ0 | 13-129 | None |
| A0A4Y9L2P6 | 2-115 | None |
| A0A2P7AXV2 | 15-187 | None |
| A0A2X1AFM9 | 11-220 | None |
| A0A6B1HC13 | 3-166 | None |
| A0A2N6FAS3 | 65-333 | None |
| A0A6G6YTA7 | 185-404 | None |
| A0A1C7F4B9 | 22-303 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.