DPCstruct | MC57115
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 117 ± 10 aa |
| Standard deviation of domain lengths | 10.21 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 41.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0110 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0RRR0 | 1-118 | ARSFKLMVQVSDQLAKSPGWDQQVFNEWLMRPSHGGHQSAYAHLRVLDIDKWLNSKIFFRSRRSRYLPGATSTAPTPILVHFNYHPD… |
| A0A0A9G7F2 | 36-157 | YNSGFFFIRPTIPSIELLDRVAGRLSREPKPWDQAVFNEELFFPSHPGYEGLHASKRTMDIYLFMNSKVLFKTVRKDAQLRKLKPVI… |
| A0A6P6AVS4 | 735-848 | None |
| A0A7S3TKG0 | 59-176 | None |
| A0A7S0J9T8 | 89-209 | None |
| A0A3Q7JCX8 | 191-301 | None |
| A0A7S3EV24 | 2-98 | None |
| A0A7S3S6X7 | 1-140 | None |
| A0A4D8YM82 | 517-629 | None |
| A0A059LS92 | 206-319 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.