DPCstruct | MC57112
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 126 ± 13 aa |
| Standard deviation of domain lengths | 13.19 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 29.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0071 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0R986 | 12-136 | YCHLREGYTGMPLVSAESEAALDATPELDYLTHIVFRMYENKGVPVMHPERFRVEVLFSAGAGVNPLTARAPDHTLPTLPLTQLNLD… |
| A0A1B7NPM6 | 370-486 | QASPDAKSFFYFTKESHIYTLLNCILEGGIQTKIARRAIPELDYLSQICFELYEAQDSESATFSYSIRISISPGCHTFDPLDVQLDS… |
| A0A835R4H9 | 242-380 | None |
| I2H0X0 | 990-1117 | None |
| A0A1E7FIS7 | 36-164 | None |
| A0A5K1JTG4 | 226-350 | None |
| A0A0G4M0L8 | 164-291 | None |
| A0A1P8BBN0 | 648-795 | None |
| A0A7S2PRZ2 | 286-423 | None |
| A0A7S4JL33 | 382-488 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.