DPCstruct | MC5711
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 75 ± 11 aa |
| Standard deviation of domain lengths | 11.21 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 77.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 64.16 |
| Pfam Score | 93.10 |
| Assigned Pfam label(s) | PF00010- CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1EK41 | 1-53 | KSNPSKRHRERLNSELDRLAELLPFDTNVIAKLDKLSVLRLAVNYLRTKSYFQ |
| Q4RMV5 | 1-68 | KPPPPDGVKSNPSKRHRDRLNGELDKLTSLLPFTEEVRTRLDKLSVLRLSVGYLKVKSFFNGEEQAQR |
| A0A3B4CGB0 | 2-96 | None |
| A0A4Z2HT84 | 8-88 | None |
| A0A817CE99 | 480-562 | None |
| A0A2K5ZL75 | 1-65 | None |
| A0A3Q3FZT0 | 2-66 | None |
| K7FI64 | 2-85 | None |
| A0A6P4EKU8 | 1-78 | None |
| A0A0P0ENL6 | 18-74 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.