DPCstruct | MC5710
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 147 ± 23 aa |
| Standard deviation of domain lengths | 23.41 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 78.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.58 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 38.21 |
| Pfam Score | 97.56 |
| Assigned Pfam label(s) | CL0018- PF08383 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q4RK28 | 26-166 | LMKFDVKKEGLAGLERSAQSGVHHGSGGGLNVEDRFSDDQLVSMSVRELNRHLRGFTKDEVIRLKQKRRTLKNRGYAQSCRFKRVQQ… |
| A7SHW5 | 3-102 | GVTEEELAELGVKELNRLLKSKGLSTEEQSRIKYRRRTLKNRGYAHNCRIKRISQKKSLEETNWELVQDLENLRKELEASKRERDMY… |
| L8Y459 | 33-192 | None |
| D3PFY7 | 24-170 | None |
| A0A0M3HUR0 | 31-183 | None |
| A0A1J1II23 | 187-352 | None |
| A0A0D6MBP8 | 183-328 | None |
| A0A6B0RVA1 | 59-222 | None |
| A0A6J2V2Q8 | 53-188 | None |
| Q7T3H0 | 1-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.