DPCstruct | MC571
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 148 ± 27 aa |
| Standard deviation of domain lengths | 27.41 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 78.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 46.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G9SGU0 | 1-158 | MEFEMDELNQHECMTTMSGLIKHMQRNEITPKVEEGVTPQDLPPWMKFLHTKLGNPSTQLNIRLFIAKLIVNSEEVFRPYAKFWIGP… |
| A0A819GHC6 | 36-175 | IDMEMDELNLHSCMIPMVCLLKHMETNGIIPINDRISEIPPWMICMYKKFSDPLITFNIKLFLMCLIIHTHTIFKPYACYWLTPLIH… |
| A0A820EWD6 | 2-165 | None |
| A0A815U3A6 | 138-309 | None |
| A0A5N5SRJ4 | 27-186 | None |
| A0A2G9SGU4 | 1-125 | None |
| A0A814MWE7 | 323-464 | None |
| A0A820E6V2 | 1-143 | None |
| A0A815Y6Y7 | 1-110 | None |
| A0A814ZIH4 | 1-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.