DPCstruct | MC57096
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 73 ± 9 aa |
| Standard deviation of domain lengths | 8.83 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.64 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 32.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11387 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A350YGQ6 | 1-67 | MTKDMEGGSASTLMQYLKGMQFPAQKTDLEKIAKRNGADDAVLKEIRNLPGDSFNTMADVEEACGEK |
| A0A1D2W7L4 | 1-62 | MSPEAVYNYLGGVQYPAKKPELIKHAKINGAGADVINALETLPDEEYKSQDELIRIGSQLKH |
| A0A2E6Z8W0 | 259-330 | None |
| A0A843LCV6 | 169-252 | None |
| A0A3S8T4P5 | 4-81 | None |
| A0A7V9KF92 | 2-62 | None |
| A0A106NVP9 | 32-98 | None |
| A0A841IVS3 | 3-70 | None |
| A0A535QHT3 | 1-70 | None |
| A0A1W1VAK4 | 4-64 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.