DPCstruct | MC57095
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 128 ± 21 aa |
| Standard deviation of domain lengths | 21.01 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 87.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 28.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A349U117 | 15-139 | MPKINVRYTVASKEQRDQRRNYYHDVVRKQFASHLATHHAEKLRILGIPEEQITIMRDRGEGPEGYNIHHKIPLHAGGTNDFSNLIL… |
| A0A4Z0GHD1 | 26-153 | NIYFENIKYTKRDRAEFNQLRKKFDSSVRSNFAKSIVKNEYLINFLKNSGLSNSDISMLKLGKIPRGYNVHHKFPLDDGGTNNFSNL… |
| A0A7R8RGL7 | 257-376 | None |
| B3DV77 | 4-144 | None |
| A0A356FVR7 | 59-195 | None |
| A0A356FZ52 | 38-164 | None |
| D5WBZ2 | 77-225 | None |
| A0A2X5AXT8 | 47-181 | None |
| A0A6L9FGW6 | 214-341 | None |
| A0A2A4YYA4 | 146-255 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.