DPCstruct | MC5709
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 350 ± 77 aa |
| Standard deviation of domain lengths | 76.90 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 85.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 34.35 |
| Pfam Score | 85.71 |
| Assigned Pfam label(s) | PF00082- PF02877 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q7E444 | 1-266 | MPLSSTGVAQFRGHHPTYDGRGVVIGILDSGIDPGAPGLAVTTTGAPKILDLRDFSDEGRVSLTPVTPSPQGTVRVAGRALAGAGRI… |
| Q4RH92 | 51-435 | APGMQVTTEGKPKIIDIIDTTGSGDVNMTTIAEPKDGTITGLSGRTLKIPPAWVNPSGKYRIGVKNGYEFFPKALKERIQKERKEKM… |
| X1WIL3 | 14-383 | None |
| A0A7R8W9N3 | 293-613 | None |
| A0A1W9RI96 | 34-309 | None |
| A0A6H5GJE3 | 20-388 | None |
| A0A3L6VQH8 | 41-385 | None |
| A0A3Q0KLT9 | 10-590 | None |
| A0A438E2Q3 | 84-509 | None |
| A0A819Z1B8 | 16-381 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.