DPCstruct | MC57088
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 134 ± 34 aa |
| Standard deviation of domain lengths | 34.09 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 75.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 30.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0361 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A493TSP0 | 5-116 | SSNLRPCFRVCYICGKEFGSQSISIHEPQCLEKWRIENDQLPRHLRRPEPRRPEALTGGSCVLTADNEAAYQSAQAQLLPCGNCGRT… |
| A0A7S2Y9W7 | 1-90 | RKYTIHSIDIHVPRCKKLWNEQQAKLPPSARKPLPQLPPNYDETKRNEIATRVYYEHTLEPCQFCERTFLPDRLEVHLRSCRRNHAK… |
| F6VFX2 | 78-210 | None |
| A0A139WEI0 | 812-924 | None |
| A0A1Q9EFG8 | 61-184 | None |
| A0A1I8F4G4 | 30-137 | None |
| A0A5D6Y5I4 | 1-153 | None |
| A0A4Z2CRE4 | 6-160 | None |
| A0A2K1ITR2 | 1-240 | None |
| A0A139B1B1 | 9-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.