DPCstruct | MC57082
Metacluster Properties and Pfam Annotations
| Number of structural domains | 612 |
|---|---|
| Mean domain length (aa) | 108 ± 18 aa |
| Standard deviation of domain lengths | 18.41 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 81.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 15.31 |
| Pfam Score | 90.56 |
| Assigned Pfam label(s) | CL0023- CL0279- PF13164- CL0333- CL0079 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A7APY6 | 10-115 | TLTLAVPTPQEGVNTATITHLYLCKDASFQGECTNLHLEASNCQNIETSFVKQVSSAGPDNGTFCTLYSDFDCHGQALPFTYPGIRK… |
| P09353 | 11-100 | PAKGEVFLYKHVNFQGDSWKVTGNVYDFRSVSGLNDVVSSVKVGPNTKAFIFKDDRFNGNFIRLEESSQVTDLTTRNLNDAISSIIV… |
| K9Q430 | 594-684 | None |
| A0A6A5UWY4 | 3-130 | None |
| A0A6P6QV20 | 1083-1170 | None |
| A0A1D2N5F9 | 1-167 | None |
| A0A397F2U6 | 411-507 | None |
| A0A6A5V497 | 152-268 | None |
| A0A2G6ZSS5 | 8-127 | None |
| A0A4R9L874 | 81-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.