DPCstruct | MC57080
Metacluster Properties and Pfam Annotations
| Number of structural domains | 68 |
|---|---|
| Mean domain length (aa) | 331 ± 46 aa |
| Standard deviation of domain lengths | 45.96 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 72.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 19.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A232M5Q4 | 15-355 | SGSPGTILETITHKIDESLTPMRTAASQLFQAEFDMDWDLTNFLRRQEYDATWETAVELAITLTGSNGNAQALTCMDYMCQTWPLSG… |
| A0A1Y2T9J0 | 58-393 | SFQWLLCRVRQGTALTSSEASCRHTIAKHIRQKLYSRPENCIINGNRGPPTCSMTFRSDWQPLAFVREQEYNEMPEDAIERAIMIVQ… |
| X0ADL5 | 332-631 | None |
| A0A1B8ASF3 | 425-675 | None |
| A0A395INZ6 | 40-398 | None |
| A0A0L1JIZ9 | 94-413 | None |
| Q2H2C2 | 307-581 | None |
| R1EC65 | 34-311 | None |
| A0A366SAL9 | 183-478 | None |
| A0A2H3H295 | 1-221 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.