DPCstruct | MC5708
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 73 ± 2 aa |
| Standard deviation of domain lengths | 1.79 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 84.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 62.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8ANL4 | 1-74 | MASMRESDTGLWLHNKLGATDELWAPPSIASLLTAAVIDNIRLCFHGLSSAVKLKLLLGTLHLPRRAVDEMKGA |
| Q4RFM5 | 1-75 | MASMKDSDTGLWLHNKLGSTDELWTPPSIASLLTVSVIDNIRLCFSSLSPPVKLKLLLGMLHLPRRTVDEVGLSA |
| A0A2K5DC72 | 1-75 | None |
| A0A6J8F229 | 1-70 | None |
| A0A1S3D3D8 | 1-75 | None |
| A0A7E4RIN4 | 1-73 | None |
| A0A1V4JF45 | 1-74 | None |
| Q86NP2 | 1-73 | None |
| A0A3M0KMD3 | 1-74 | None |
| A0A6G1S752 | 3-72 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.