DPCstruct | MC57079
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 229 ± 36 aa |
| Standard deviation of domain lengths | 35.68 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 79.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 17.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A167WHC9 | 338-525 | FTFSNDKVRTFIYNTLPEMRQDHVKSDMYERLLRSTTRQWKYESLKRMKNFVAKTIRSQKAAPGLGLMYINGHNHLHEYFCSTFSED… |
| A0A232LN80 | 136-342 | GFTDVEGYSRLELATRQWYISSFSNKEVDPPIQAALPALSGNPAEYRRAVARVRDFYKRFKSRTLSDARNWFAKWVALKQNHPYATV… |
| A0A094K7H9 | 86-362 | None |
| A0A177AEG7 | 8-177 | None |
| A0A3N2PQD8 | 1-287 | None |
| A0A166NT40 | 1-237 | None |
| A0A1Y6M180 | 5-206 | None |
| E9CU19 | 50-276 | None |
| A0A6A5S4Z3 | 7-246 | None |
| L8GC33 | 4-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.