DPCstruct | MC57074
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 167 ± 14 aa |
| Standard deviation of domain lengths | 14.23 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 79.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 16.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14334 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C5XZL3 | 2-134 | QVSLGAGIPQPMLDALPSGAQVSVQYQVQVRGKRAIIWDARLWKGTATASVVFDPLTGRYTCEEALDDVIVSSKEVSSPEVARQWLV… |
| A0A4P7NXA6 | 23-201 | LGFSSFIYAADTPPSSIQILYLNDYQDNQQLVLDASVRFQFKEPVLTALQHEIPLTFNTEIELNEVHSLLGFNMHRNRVTIQYQSQL… |
| A0A536VUB0 | 16-185 | None |
| A0A011QF83 | 270-437 | None |
| A0A3N5VZH6 | 74-236 | None |
| M1Z1U2 | 23-203 | None |
| A0A538SEL9 | 378-555 | None |
| G0GG23 | 17-152 | None |
| A0A7V3BPF2 | 66-242 | None |
| A0A2V8AHK2 | 8-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.