DPCstruct | MC57071
Metacluster Properties and Pfam Annotations
| Number of structural domains | 80 |
|---|---|
| Mean domain length (aa) | 232 ± 37 aa |
| Standard deviation of domain lengths | 37.31 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 68.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 14.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A326RPH4 | 14-293 | LAFLAFFMTMNLLLTSCVDEPEAPKIELADRTPVAKVKAWFEENKTKLRLPERGSNLRTESQELILPFFEKEPDWDKFHHYYFPDGR… |
| A0A7U3Q511 | 19-284 | KKKSLITLTILTGLCLFLFACRKDIIFMVDGKESVNASIMENAKIWRLQNLKKSTQVLKPLWADSWKIMSTSNKELLIVPAPEHYMT… |
| A0A7G9QKG0 | 3-284 | None |
| A0A1Q5ZT74 | 13-267 | None |
| C2FUY5 | 5-272 | None |
| A0A1T3EBL1 | 4-214 | None |
| A0A1H4E9I3 | 4-170 | None |
| A0A521G8U0 | 1-194 | None |
| A0A7K3N799 | 28-261 | None |
| R7DET1 | 14-212 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.