DPCstruct | MC5707
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 44 ± 1 aa |
| Standard deviation of domain lengths | 0.80 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 88.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.96 |
| Mean intra-cluster sequence similarity (%) | 71.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0451 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E7F8B1 | 117-160 | FRLSPCERCRCEVNKEVYCTISGCPALHCVNPVYEPNHCCPVCK |
| A0A6A4S3Y1 | 543-586 | FKVSPCEKCRCEPSGEVLCSVAACPQTECVDPQYEPDQCCPICK |
| A0A151P101 | 171-214 | None |
| S4RZK8 | 1-44 | None |
| A0A1S3N322 | 226-269 | None |
| W5Q0N3 | 139-184 | None |
| F6YMS4 | 226-269 | None |
| A0A3B3I9K0 | 109-152 | None |
| A0A2U9CRD1 | 5-48 | None |
| H3B3K7 | 225-270 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.