DPCstruct | MC57069
Metacluster Properties and Pfam Annotations
| Number of structural domains | 66 |
|---|---|
| Mean domain length (aa) | 222 ± 49 aa |
| Standard deviation of domain lengths | 48.69 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 88.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 23.95 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | CL0664- CL0023- CL0037 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A139NDX3 | 15-228 | TATQTDAEKLASDLIEILGEEKVFTFFADDTPLAEFAFSSQEKVYNRLKSLQFLLSESAGILLVNLSGSRLLLPNPEYFKKIHVSFT… |
| A0A3S4EFV9 | 16-240 | APNKTLAAQLYGEMKAFFPENAVEYFVSYYDYYQPEAYVPSSDTFIEKDSAVNEHIDQMRLSATKALLERRDVIVVASVSAIYGLGD… |
| A0A554JHU3 | 37-327 | None |
| A0A090MU98 | 214-503 | None |
| A0A0G0NRW5 | 28-296 | None |
| A0A7T8XVD6 | 118-420 | None |
| A0A0C2VEX3 | 3-195 | None |
| A0A5C8EGG8 | 16-286 | None |
| A0A2E1GS39 | 8-165 | None |
| A0A0K9CNE2 | 7-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.