DPCstruct | MC5706
Metacluster Properties and Pfam Annotations
| Number of structural domains | 4 |
|---|---|
| Mean domain length (aa) | 57 ± 4 aa |
| Standard deviation of domain lengths | 3.90 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 72.56 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | CL0010- PF12140 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q4RC31 | 1-59 | PLVCIYLNKYGKVGPHLDHQRIQQLPDHFGPGRASSVLQQCVQACVGSLLTIKPQSSPA |
| A0A401PZ30 | 35-84 | IICIYVNKHACAGPHLDKKKLQQLPDHFGPARASMVLQQAVQACIDCAYQ |
| A0A2G9R3R2 | 14-72 | None |
| A0A7F8PV12 | 100-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.