DPCstruct | MC57057
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 107 ± 10 aa |
| Standard deviation of domain lengths | 9.75 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 92.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 25.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A845I338 | 1-107 | MVFQLSPAEMYQLLAVLERKLPGVKFTGHGPAHDKFMDCKVQDGGFFVRMGQTGRPIIPVPIVPADAVRIISLLYKQILANDTHLCA… |
| A0A2M8TZV0 | 36-121 | DWGQKLSLQLTREELPVIAATVLGLLPRCTYKNHGPNQDKGLEIVHQGTHLFVRVFQKDRGVVAVPVTAADSYALGALCLRQLRKT |
| A0A6G9QR79 | 101-208 | None |
| A0A385FW59 | 138-249 | None |
| A0A1D8KCR8 | 183-301 | None |
| A0A179BPI9 | 163-261 | None |
| A0A4R8L4R4 | 228-335 | None |
| A0A240EEV2 | 60-162 | None |
| A0A5P9BH43 | 69-178 | None |
| A4JTT7 | 273-390 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.