DPCstruct | MC57049
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 321 ± 89 aa |
| Standard deviation of domain lengths | 88.72 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 79.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 24.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0456 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N5TAX2 | 1-276 | MGNADTKLQFRKAVVQLISKTQPIDASDDSFWEQFWGDHDTSIQDVFTLIPASEIRALREEAPSNLATLCYKAVEKLVRSADTGCST… |
| A0A183RE15 | 1-239 | MGGDNSKLGYRNAVIQLTTKTQPVDSNDDNFWDQFWAEYPMSIQDIFALIPAAEIRALRTEAPNNLATLCYKAIERIAQVSESASPT… |
| A0A453FMR6 | 44-397 | None |
| A0A672HVF7 | 1-286 | None |
| D3BIY8 | 1-482 | None |
| A0A813WDN2 | 1-219 | None |
| A0A162N2T2 | 260-558 | None |
| A0A395J226 | 1-302 | None |
| A0A3R6W0A6 | 1-330 | None |
| A0A5K3FAR7 | 1-346 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.