DPCstruct | MC57048
Metacluster Properties and Pfam Annotations
| Number of structural domains | 80 |
|---|---|
| Mean domain length (aa) | 95 ± 14 aa |
| Standard deviation of domain lengths | 13.97 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 77.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 24.00 |
| Pfam Score | 72.11 |
| Assigned Pfam label(s) | PF17556- CL0621- PF04706 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N5T8X3 | 7-86 | KDVCYSGSDCGEGECCARPMLSANSYCMPLKKRSDFCATIPIMLDPDEEVYFSDCPCEKHLNCVGLENRSICMNLRNFED |
| L7LSU6 | 58-138 | TGKVRGGTICLNTEECGVGKCCLRRGKDPRRKCRRFQRIGQRCTDDQMMGGYYQNYCPCNRHSVCAVVGHVLKCVKRQPIQ |
| V9KRV4 | 155-251 | None |
| A0A6S7H8A3 | 211-305 | None |
| A0A6S7HFC3 | 4-100 | None |
| R7UQI6 | 133-235 | None |
| A0A485NFE6 | 28-108 | None |
| H0VX04 | 140-228 | None |
| A0A4W4EBL4 | 26-102 | None |
| A0A4Y2AC05 | 7-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.