DPCstruct | MC57040
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 72 ± 9 aa |
| Standard deviation of domain lengths | 9.13 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 60.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A444SKG1 | 170-235 | VSLGSFKDENDYLHEIYSKLKHGEKVFSVECIENNVQFAQLSERDNMILMHSFSYSEVPQNSSVIL |
| A0A5N5SXD6 | 13-86 | GMTKQFVTVSLESFKDENDYLHEIYSKLKHGEKVFSVECIENTVQFAELSERDNMILMHSFSYSEVPQNSSVIL |
| A0A444SHG1 | 13-81 | None |
| A0A444SZP5 | 51-132 | None |
| A0A444SY71 | 22-114 | None |
| A0A444SNJ1 | 114-180 | None |
| A0A444SK05 | 7-88 | None |
| A0A444SJC8 | 1-70 | None |
| A0A444SJ11 | 39-120 | None |
| A0A444SEA3 | 19-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.