DPCstruct | MC5704
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 171 ± 16 aa |
| Standard deviation of domain lengths | 15.92 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 72.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 28.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q636W5 | 1-186 | MSRYDDSQNKFSKPCFPSSAGRIPNTPSIPVTKAQLRTFRAIIIDLTKIIPKLFANPSPQNIEDLIDTLNLLSKFICSLDAASSLKA… |
| A0A1S9YFV1 | 1-167 | MSGNIIPMITPTVPITPIQETELINLFSILQTTATAYFANPDVINRQELQGSLNQLYIFLRDQFPTVDGRNATRYSMFLLLTTVNQL… |
| A0A386ZVN7 | 1-199 | None |
| A0A7X2E3Y3 | 1-186 | None |
| A0A6I0BRQ3 | 1-165 | None |
| J9B151 | 9-172 | None |
| A0A7M2AA92 | 11-198 | None |
| A0A222WTF7 | 2-179 | None |
| A0A2C4PRE0 | 37-199 | None |
| W8YLF8 | 108-255 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.