DPCstruct | MC57039
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 121 ± 8 aa |
| Standard deviation of domain lengths | 8.23 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 36.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07086 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N5SWZ4 | 42-156 | PLKWEYLWLAGTLSCFVGLTAVRKNRTLLLQVYFVFVNLFSTVPVLFALMLYFSEFWEFCSNSEQENIQIWQGYPLAALWYAFLIIA… |
| A0A6J1T6Q7 | 6-120 | FQPLWWEYLWCVSLLLSFIGLSAARKNRISLMKRYMLGIIIFGIGPVLYAAGYYFKEAWQYVRTGDTEDLHLWQGYPYALLWFAFII… |
| A0A182VQQ7 | 226-346 | None |
| A0A822DRB4 | 18-148 | None |
| L9KKN6 | 68-182 | None |
| A0A6I9PVS3 | 103-234 | None |
| A0A1D2NMQ4 | 56-193 | None |
| A0A5E4MXU3 | 27-140 | None |
| A0A336MN86 | 343-461 | None |
| A0A2J7R7E6 | 222-335 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.