DPCstruct | MC57036
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 233 ± 43 aa |
| Standard deviation of domain lengths | 42.59 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 69.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 22.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16124 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N5SNJ9 | 1-281 | MIDYCELPICRHNSFARYFGDSKPDCRKQCDFCTNSKQTEKRVDDFKACLMRKKEFRFGPSNVTEDFDESDLYEGGRRGQKRLYEDY… |
| A0A2G9U9Q6 | 2-183 | MKASKGNFESGDLYGGGKRAHDDDDYGCNSSDAWERLEKEEAARMRDVVHSEFAKRRKIERQRESDLKEVYIPSTEYPIKEPKAKTI… |
| A0A6P4YAQ0 | 102-356 | None |
| T0MDM3 | 108-269 | None |
| A0A482X2J0 | 397-661 | None |
| A0A0V0T8Z2 | 390-641 | None |
| A0A0A9XJM7 | 1-274 | None |
| A0A0N4UF20 | 93-266 | None |
| A0A0R3WQ88 | 57-331 | None |
| A0A7T8H3B1 | 303-535 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.