DPCstruct | MC57030
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 160 ± 11 aa |
| Standard deviation of domain lengths | 10.95 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 92.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 35.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E3GI82 | 19-184 | NKHRIAKEKKHAVGSAVWYWHHSKAGNLSPHAINNDLIATCALINGGYNGFDDREKYYKRAVIALNIKTCLNLDKKIVDNLDNYTKF… |
| A0A2D0KGS9 | 74-232 | SKQDRDKLLSSPHSVLSAFWFYNVYKNVSSSAGDDDFNKVTALINGGFNGYNDRLDYLKKAIRVFKAGHLNQLLNNDRFEFNGSSIY… |
| E8WJ98 | 181-335 | None |
| A0A1I5BXL5 | 38-174 | None |
| A0A2P5LIT0 | 313-467 | None |
| A0A553DTW1 | 301-472 | None |
| A0A378T936 | 246-412 | None |
| A0A1N7PS17 | 359-534 | None |
| A0A2L0I987 | 8-150 | None |
| A0A172XU88 | 546-722 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.