DPCstruct | MC57027
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 188 ± 23 aa |
| Standard deviation of domain lengths | 22.81 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 28.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0068 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1A8HXX9 | 24-176 | SCLAAYRENNSVDKTVLTYYEERNVTALHLEVTSGEEQANRLVKEKILNMLGPPRLLSPPKVEDGRNEAEEKLRREAKEKAEETRSR… |
| W4FSD8 | 321-518 | RAQALSQEDADKSGNTDIEFTRRYDLFKRETNPANQSGLVAYFERDQAVEVLELELDSEEMYTSKKHFVDPIAKYMEQGGKPYNFHP… |
| A0A6A4WE74 | 148-302 | None |
| A0A7R9J784 | 40-209 | None |
| A0A5A8E1I4 | 370-544 | None |
| A0A7G2CJU3 | 420-650 | None |
| E2BB39 | 392-582 | None |
| A0A1B6EEZ7 | 15-197 | None |
| A0A7J8JQP8 | 17-212 | None |
| A0A1A8VWU6 | 913-1124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.