DPCstruct | MC57022
Metacluster Properties and Pfam Annotations
| Number of structural domains | 373 |
|---|---|
| Mean domain length (aa) | 340 ± 73 aa |
| Standard deviation of domain lengths | 72.92 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 79.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.41 |
| Mean intra-cluster sequence similarity (%) | 14.01 |
| Pfam Score | 64.06 |
| Assigned Pfam label(s) | CL0431- PF03455- CL0330- PF15019- PF20014 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I8HSU6 | 20-349 | FFYELHRNSPGADPVSEFRYCPLDVSLNVLEEWEKRIVEYAMPSWYEFDHLSDSLCSVFTDINSVFTFLFVKYYRDEDNANGLRCLA… |
| A0A7V1Z7E5 | 1-260 | MVQELLYTSAERGLDLGTTGFCTVARTRGLSKRLERLLHDLSVYKWDLRSGHNPVVYMYTRANLDGQSLFILSRVAPAPADYSGRSN… |
| A0A1S3PW28 | 20-443 | None |
| A0A673W0H0 | 45-311 | None |
| A0A7R9Y9I8 | 238-499 | None |
| A0A7S2RY04 | 536-844 | None |
| A0A7M3M4G2 | 2-317 | None |
| C4LVT0 | 282-688 | None |
| A0A0K0E693 | 219-705 | None |
| A0A1Y1NJD5 | 7-426 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.