DPCstruct | MC57019
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 191 ± 39 aa |
| Standard deviation of domain lengths | 39.43 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 70.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 40.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0018 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I8HGY5 | 24-180 | GNSCSRNWNLKPELGAQLSSNRPGQCLLQLTAEERFTYASEGIPPPTGLPLSAHEEKALKRIRRKLKNKWSAQESRRRKKEYMESLE… |
| A0A0R3WML3 | 1-110 | LTDEEKRTLLAEGYSIPTRLPLSKQEERNLKKIRRKIKNKISAQESRRKKKEYVESLEKRVEAYAQENADLKRRLDGLEGTNRSLLS… |
| S4RHP6 | 1-158 | None |
| S9WSP4 | 13-206 | None |
| A0A6P6CBQ7 | 99-334 | None |
| A0A7R9ABN0 | 897-1034 | None |
| A0A0N5DAV4 | 164-394 | None |
| A0A6V7XSH7 | 378-538 | None |
| A0A7E4SBS9 | 176-297 | None |
| A0A6P8IXG8 | 71-240 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.