DPCstruct | MC57018
Metacluster Properties and Pfam Annotations
| Number of structural domains | 72 |
|---|---|
| Mean domain length (aa) | 165 ± 33 aa |
| Standard deviation of domain lengths | 32.89 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 75.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 25.42 |
| Pfam Score | 98.00 |
| Assigned Pfam label(s) | PF04698- CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I8HDJ0 | 12-189 | STPRSAVAALTPAECAAIGDVLRRDRALRLLDWGRVGRVADQVERLRLAQCGDGLASCRLCGLRLRHRWWRPSGRCSDCGYKYCDAC… |
| A0A3Q3WCK9 | 1-89 | MGRKLDLSGLTANEAEHVLQVVQRDMKLRRKEEERLSELRQELDEEGSRCLLLSRQYCFNQHCLYNVCKACRVYSKEDNAWLCSACQ… |
| A0A6A4V8C1 | 48-167 | None |
| A0A182G2M6 | 1-162 | None |
| A0A671DVP3 | 1-176 | None |
| A0A813TQQ8 | 16-185 | None |
| A0A1S3GJL0 | 67-253 | None |
| Q22366 | 1-177 | None |
| A0A212C7R0 | 1-109 | None |
| A0A0K0EDV2 | 397-632 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.