DPCstruct | MC5701
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 213 ± 26 aa |
| Standard deviation of domain lengths | 26.04 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 15.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A178DW53 | 2-177 | HYHGIAIAEVWIGQSPVNVGDVTGSALYGTIWKMLYADCAFKRRGCSKGPREYAFDTHYAFESFFIKKGQTRIKIEDVQFPNKQIGK… |
| Q0V5I8 | 1-213 | MLSTVKILGALLPLISLASPLATSIPSGDTIQLALGNKPVNVGSMWGNELRDTLIANLRTACPDATRDFCGVVPAGIKAISNFPIYA… |
| A0A2T2P2P4 | 2-198 | None |
| A0A4Z1IZJ5 | 379-580 | None |
| A0A6A6A7V5 | 91-334 | None |
| K2S7H2 | 396-651 | None |
| A0A0D2HGD0 | 383-598 | None |
| A0A6A5ZTW0 | 238-432 | None |
| A0A6A5WBI3 | 35-181 | None |
| A0A0C3D741 | 153-359 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.