DPCstruct | MC57008
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 96 ± 10 aa |
| Standard deviation of domain lengths | 10.08 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 44.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X6PDL8 | 5-94 | DESEIVRELSIYVLWKILNYPKKTKYRQINKQALYDNLLRRCCQRNVDIDKVMANMERRLEQCGFGIRAEDRNWYYQKDMHICIHFV… |
| X6P1L6 | 78-166 | NELKIKREMCLHILWNILKYPKHIKYRQINKQALYNYLFQKCHQLNVNLKQAFEDMEKQLQYFGFIKENDDNWYYRYNHIQISYLWG… |
| X6P6I3 | 93-192 | None |
| X6LTX6 | 1-86 | None |
| X6LN83 | 1-95 | None |
| X6L8N5 | 1-102 | None |
| X6P947 | 108-198 | None |
| X6P7E1 | 130-226 | None |
| X6LBA4 | 50-150 | None |
| X6NXI3 | 156-256 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.