DPCstruct | MC57006
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 385 ± 29 aa |
| Standard deviation of domain lengths | 29.42 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 80.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 40.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X6P896 | 3-318 | LQVGNPKKSSLEVHAHIQWYNDFDDIEANCIKWTCLILNNSWHFRTNDSFEMKYLSNFCAEFNSCNVTWKDDFIYKFPLNPYVATFE… |
| X6MP38 | 40-427 | DNEKWEEYEIVFDYACRRIVLFEPRQLKVKTLQVGNPKQNSSEFDIDIEYYNDFSAVRNTHTKWCGLILNQRWHFRMLHQTERDCFS… |
| X6P5Y4 | 170-585 | None |
| X6LAJ3 | 1-423 | None |
| X6PFK6 | 1-403 | None |
| X6P5X7 | 238-599 | None |
| X6NXI3 | 268-655 | None |
| X6NMF9 | 38-410 | None |
| X6N1L3 | 104-509 | None |
| X6NZF7 | 96-474 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.