DPCstruct | MC57000
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 164 ± 14 aa |
| Standard deviation of domain lengths | 13.54 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 46.19 |
| Pfam Score | 85.71 |
| Assigned Pfam label(s) | CL0489- PF19633 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P0XCN3 | 97-274 | TAVDGHYQIGIYTVRPIAEGEEITFDYNSVTESKEEHEASVCLCGSQICRGSYLNFSGEGAFEKVLMEFHGVLDRHSLLLQACEANS… |
| X6NTX1 | 1-169 | MAVHGKFQIAVYAIRDIKHGEELCFDYNSVTEDEKEWEQSICLCGMRNCRNFYLAYAGTGSYTDVLHNKHHFLHRTAALYHACSKSK… |
| A0A453RUF0 | 639-815 | None |
| A0A7J7N6F9 | 7-144 | None |
| A0A4U5P462 | 33-179 | None |
| X6M359 | 1-175 | None |
| X6N607 | 353-509 | None |
| A0A1D6IYB4 | 278-452 | None |
| A0A482ST21 | 1-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.