DPCstruct | MC570
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 97 ± 10 aa |
| Standard deviation of domain lengths | 10.17 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 39.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00082 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A819Z1B8 | 179-269 | REEFQSFVDALKEIEKKYNDPGPFLDCIVWNDGEKWIACIDTSEQGELDQCKCLTNYFDSHEFATFSAIDMVTYSIQIHDEINILEI… |
| A0A819G401 | 2-94 | REEFQSFVDALKEVEKKYNDPGAFLDCIVWNDGDTWIACIDTSEQGELDQCKCLTNYIDSHEFATFSAIDMVTYSVQIHHEINILEI… |
| A0A3L6VQH8 | 167-274 | None |
| A0A7R8W9N3 | 387-496 | None |
| A0A7R9PBK7 | 2-94 | None |
| A0A0N4THZ6 | 1-80 | None |
| A0A182EKP3 | 143-230 | None |
| A0A3Q7FHC0 | 3-100 | None |
| A0A5B7CU04 | 187-277 | None |
| A0A7J7N5D0 | 284-378 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.