DPCstruct | MC57
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 94 ± 11 aa |
| Standard deviation of domain lengths | 11.36 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.86 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 55.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B9S204 | 1-79 | MAKFNVVQKRRREQISQRKRAVHGDPLTGKLKNKKQPLSVSGKRQRKLLKKWRREQKEAIEKGLVTMEDVEMAAAEGFM |
| A0A161YGN5 | 4-104 | FNVVQRRRRAAIADHKRAKHGDPVTGKLKLRAPTIPISGKRKRKLFKKWRRDQKDAIAKGLITMEDVEMAVAEGTSENVSKAPLAFS… |
| A0A822XP25 | 64-154 | None |
| A0A2I0JEE8 | 1-79 | None |
| A0A2I0XC86 | 1-108 | None |
| A0A6J0NA72 | 4-98 | None |
| A0A427BB47 | 4-87 | None |
| N1R052 | 1-87 | None |
| A0A0B0NPL8 | 5-116 | None |
| A0A5D2XWP5 | 5-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.