DPCstruct | MC56998
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 206 ± 26 aa |
| Standard deviation of domain lengths | 25.94 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 91.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 23.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V4LQ04 | 21-178 | LKGTPGYFRIARTCKGQWWFLDPENKPFYYKGVCAVNRAGTPGGRRADPGPYAATVNKKYHYQAGVDSFISACIGKIKELNFNALGA… |
| M5TDS3 | 182-361 | LAANPGPRNRNRYGGWVTGPQLESTGRFRTQKRNGKWWFVDPEGRLFWSQGITGVRLSQSTQTRGRENYFTEIHEGGDFRIANLKRK… |
| A0A5C6D317 | 29-224 | None |
| A0A6I3RJF4 | 70-320 | None |
| R6X2K2 | 262-489 | None |
| A0A1G2ZGL0 | 269-495 | None |
| A0A842W3S6 | 45-260 | None |
| A0A4Q3VB79 | 4-191 | None |
| D2VAY6 | 246-441 | None |
| A0A2E6TMH3 | 757-940 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.