DPCstruct | MC56990
Metacluster Properties and Pfam Annotations
| Number of structural domains | 62 |
|---|---|
| Mean domain length (aa) | 523 ± 70 aa |
| Standard deviation of domain lengths | 69.76 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 14.00 |
| Pfam Score | 95.83 |
| Assigned Pfam label(s) | CL0172- CL0177- CL0025 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C3QBH1 | 13-422 | LYCTLTKSLPMSPLVKLRLNGRDYYRSVLVVRDDSKIRRTAELLGKTLVYGRYNCPGSGLLPRIMLRRVGLTNDKFFEVVKLGNDES… |
| A0A6L9J1H2 | 1-591 | MKRLTFALSLLLPFVLLASALAVPLADTSPAEAQDSGLSIRIGSKQFTEQLILGNLMALALQEYGYDATFTPLGSTAAAHEALIAGE… |
| R6YCG6 | 8-537 | None |
| A0A411PJI6 | 191-672 | None |
| A0A2N6G0N8 | 276-771 | None |
| A0A1V5U3V3 | 171-632 | None |
| A0A7K2EEV6 | 3-563 | None |
| A0A0C5VJZ6 | 3-501 | None |
| A0A090S8G4 | 12-414 | None |
| A0A6I7PZM4 | 141-705 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.