DPCstruct | MC5699
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 74 ± 20 aa |
| Standard deviation of domain lengths | 20.28 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 85.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 49.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15879 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S4LB87 | 216-299 | MPLPWEATIPFVLLTTMFAAAGTLLNVSQRAQNQGKPPRYNIDDWDEMMMERDKRLTGHRRGQRTDPVAPEGFATSSTWYTEKT |
| Q0UPG3 | 1-67 | MGVPFEALLPYAVMTGFFAFSAVSLGKLKEIQNGGKRPRRGIDQWDQTDRAAAPAGFELNNPWRCEQ |
| A0A2U3EPG2 | 140-224 | None |
| A0A179HTX8 | 1-46 | None |
| A0A4U0W6G0 | 58-142 | None |
| A0A6A5V3I4 | 1-107 | None |
| A0A1Y2HAU4 | 1-88 | None |
| A0A146FKI4 | 1-54 | None |
| A0A5M3Z346 | 1-50 | None |
| A0A4Y8CNW4 | 16-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.