DPCstruct | MC56989
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 211 ± 23 aa |
| Standard deviation of domain lengths | 22.70 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 20.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H5X254 | 9-194 | MNPAWVSVLRYSCRWAFQAQDEPTAARKVTNALHLWGAYQEGIWFARNYDDISETFYLRQCLERLEADGTVGQCNDFADLLLCLQTS… |
| A0A7V2Z1F6 | 473-690 | SGLTAACVKKTSDTWQWKAGNFNGLGTNEIDANISGQHNLFVVLGEPSSPWSNTYGSACNAWRTVLDRSCDWADSATNEAGAVEMIT… |
| A0A7J4PIK4 | 10-225 | None |
| A0A847YAL6 | 7-233 | None |
| A0A7C7VAY8 | 52-265 | None |
| A0A3C0BGR0 | 114-348 | None |
| A0A847K142 | 45-239 | None |
| A0A1B9NA30 | 183-402 | None |
| A0A847JXX3 | 168-359 | None |
| A0A2M7S9G4 | 1-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.