DPCstruct | MC56985
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 270 ± 59 aa |
| Standard deviation of domain lengths | 59.46 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 88.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 21.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00771 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A655MW12 | 42-254 | PRLIFSGQEVALRELSCPAILESIRQLAPETISERFVTRLVDEFREHAFLSIEEILPLKISENSLIFLLRALVRERVSLHLFPKILE… |
| A7DZT0 | 1-163 | MTVGEIQKILQNLLKERVSIKDMVTILESLADNSRTTKDLELLTEYVRFSLSRNICESLIDEKGGITVMTLAPEVEELIGNNIQKSM… |
| A0A7X9AF72 | 24-339 | None |
| A0A6L4ZP52 | 54-383 | None |
| A0A6N7FTW0 | 3-172 | None |
| A0A848VEQ5 | 2-146 | None |
| I0X5R7 | 57-339 | None |
| A0A521UCR6 | 296-499 | None |
| A0A6G6WPP6 | 963-1251 | None |
| A0A658KHA3 | 2-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.