DPCstruct | MC5698
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 307 ± 27 aa |
| Standard deviation of domain lengths | 27.11 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 24.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0464 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6XMQ3 | 104-407 | IEDAENCDLNSDAYLDFSKRYTTKIQTPSYVHNRPVVNVALQKLDVRVSEFVHQALGHILVPIIYLPFLLEDPHLAASWNLGEDLRI… |
| Q0UIH8 | 1-310 | MDDLVRDARDLDTDSSAYLDFHRRYTAAIVAPIYLQQYVSLNSTSQSLDVRIFEFVHEALNRSQNLPVYLPLLAEDPNQASAWNIAQ… |
| A0A168A982 | 223-574 | None |
| A0A175W9K6 | 276-583 | None |
| A0A1V6T7N9 | 159-442 | None |
| A0A423WP87 | 952-1267 | None |
| A0A0M8N629 | 123-381 | None |
| A0A2C5ZDW8 | 142-484 | None |
| A0A2P5HZX6 | 268-555 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.