DPCstruct | MC56968
Metacluster Properties and Pfam Annotations
| Number of structural domains | 288 |
|---|---|
| Mean domain length (aa) | 233 ± 56 aa |
| Standard deviation of domain lengths | 56.24 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 83.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 16.69 |
| Pfam Score | 83.85 |
| Assigned Pfam label(s) | PF04406- PF09660- PF11795- PF20768- PF10172 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L7JUK4 | 32-282 | EIIHGMLVDNVKKTKREIFYASPNIFKRQETVNKMIDKFAHVHKVRLIDFNVSASLKGLFYGEVTFIESNKAYTLYQNLIPDMNEVT… |
| K1TG56 | 6-144 | IKNVRKILFIENKANYIDYIQNKQESDEFVIYHGGMYSPIKGKFFKKIYEACENQEFYHWSDIDIGGFRIFTRLKKIIPELQEYKMD… |
| A0A0Q4XQA8 | 117-319 | None |
| A0A7J0G9F4 | 1-195 | None |
| A0A1Q9SLF6 | 6-163 | None |
| A0A843X7B1 | 208-473 | None |
| A0A0D3H3V7 | 246-507 | None |
| A0A517ZGW6 | 227-547 | None |
| A0A7W1HN18 | 12-292 | None |
| A0A6A6A0M1 | 135-459 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.